Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [388740] (8 PDB entries) |
Domain d6xbsa_: 6xbs A: [388796] automated match to d1jc5b_ complexed with cl, co, kfv, so4 |
PDB Entry: 6xbs (more details), 1.5 Å
SCOPe Domain Sequences for d6xbsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xbsa_ d.32.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]} sltridhigiachdldatvefyratygfevfhtevneeqgvrqamlkindtsdggasylq lleptredsavgkwlakngegvhhiafgtadvdadaadirdkgvrvlydeprrgsmgsri tflhpkdchgvltelvtsaa
Timeline for d6xbsa_: