Lineage for d6x1qa4 (6x1q A:626-728)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763159Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries)
  8. 2763161Domain d6x1qa4: 6x1q A:626-728 [388791]
    Other proteins in same PDB: d6x1qa1, d6x1qa3, d6x1qa5, d6x1qb1, d6x1qb3, d6x1qb5, d6x1qc1, d6x1qc3, d6x1qc5, d6x1qd1, d6x1qd3, d6x1qd5
    automated match to d1jz8a2
    complexed with mg, na

Details for d6x1qa4

PDB Entry: 6x1q (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution structure of b-galactosidase with a 200 kv cryoarm electron microscope
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d6x1qa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x1qa4 b.1.4.0 (A:626-728) automated matches {Escherichia coli [TaxId: 83333]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsv

SCOPe Domain Coordinates for d6x1qa4:

Click to download the PDB-style file with coordinates for d6x1qa4.
(The format of our PDB-style files is described here.)

Timeline for d6x1qa4: