Lineage for d6x1qb1 (6x1q B:2-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775161Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries)
  8. 2775163Domain d6x1qb1: 6x1q B:2-219 [388717]
    Other proteins in same PDB: d6x1qa2, d6x1qa3, d6x1qa4, d6x1qa5, d6x1qb2, d6x1qb3, d6x1qb4, d6x1qb5, d6x1qc2, d6x1qc3, d6x1qc4, d6x1qc5, d6x1qd2, d6x1qd3, d6x1qd4, d6x1qd5
    automated match to d1f4ha3
    complexed with mg, na

Details for d6x1qb1

PDB Entry: 6x1q (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution structure of b-galactosidase with a 200 kv cryoarm electron microscope
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d6x1qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x1qb1 b.18.1.0 (B:2-219) automated matches {Escherichia coli [TaxId: 83333]}
mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa
wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg
cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage
nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d6x1qb1:

Click to download the PDB-style file with coordinates for d6x1qb1.
(The format of our PDB-style files is described here.)

Timeline for d6x1qb1: