Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries) |
Domain d6x1qb1: 6x1q B:2-219 [388717] Other proteins in same PDB: d6x1qa2, d6x1qa3, d6x1qa4, d6x1qa5, d6x1qb2, d6x1qb3, d6x1qb4, d6x1qb5, d6x1qc2, d6x1qc3, d6x1qc4, d6x1qc5, d6x1qd2, d6x1qd3, d6x1qd4, d6x1qd5 automated match to d1f4ha3 complexed with mg, na |
PDB Entry: 6x1q (more details), 1.8 Å
SCOPe Domain Sequences for d6x1qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x1qb1 b.18.1.0 (B:2-219) automated matches {Escherichia coli [TaxId: 83333]} mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d6x1qb1:
View in 3D Domains from same chain: (mouse over for more information) d6x1qb2, d6x1qb3, d6x1qb4, d6x1qb5 |