SCOPe 2.07: Domain d6yi1a1: 6yi1 A:35-361

Lineage for d6yi1a1 (6yi1 A:35-361)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.8: Glutaminyl-peptide cyclotransferase-like [142532] (1 protein)
   part of Pfam PF04389

6. Protein Glutaminyl-peptide cyclotransferase, QPCT [142533] (2 species)
   Glutaminyl cyclase

7. Species Human (Homo sapiens) [TaxId:9606] [142534] (27 PDB entries)
   Uniprot Q16769 33-361

8. Domain d6yi1a1: 6yi1 A:35-361 [388784]
   Other proteins in same PDB: d6yi1a2, d6yi1b2
   automated match to d2zeha_
   complexed with 66n, dio, gol, mes, ort, peg, pg4, pge, phe, so4, zn

Details for d6yi1a1

PDB Entry: 6yi1, 1.92 Å

PDB Description: crystal structure of human glutaminyl cyclase in complex with glu(gamma-hydrazide)-phe-ala

PDB Compounds: (A:) Glutaminyl-peptide cyclotransferase

SCOPe Domain Sequences for d6yi1a1:

Sequence; same for both SEQRES and ATOM records:

>d6yi1a1 c.56.5.8 (A:35-361) Glutaminyl-peptide cyclotransferase, QPCT {Human (Homo sapiens) [TaxId: 9606]}
awpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhimqr
iqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnrvf
vgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqdsly
gsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqai
ehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmdd
neenldestidnlnkilqvfvleylhl

Timeline for d6yi1a1:

• d6yi1a1 is new in SCOPe 2.07-stable
  
• d6yi1a1 appears in the current release, SCOPe 2.08