Lineage for d6xbta_ (6xbt A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549945Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2549946Protein automated matches [190239] (26 species)
    not a true protein
  7. 2550121Species Streptomyces coelicolor [TaxId:100226] [388740] (8 PDB entries)
  8. 2550125Domain d6xbta_: 6xbt A: [388741]
    automated match to d1jc5b_
    complexed with co, coa, kfv, so4

Details for d6xbta_

PDB Entry: 6xbt (more details), 1.49 Å

PDB Description: streptomyces coelicolor methylmalonyl-coa epimerase (q60a) in complex with 2-nitronate-propionyl-coa
PDB Compounds: (A:) Methylmalonyl-CoA Epimerase

SCOPe Domain Sequences for d6xbta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xbta_ d.32.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
sltridhigiachdldatvefyratygfevfhtevneeqgvreamlkindtsdggasyla
lleptredsavgkwlakngegvhhiafgtadvdadaadirdkgvrvlydeprrgsmgsri
tflhpkdchgvltelvtsaa

SCOPe Domain Coordinates for d6xbta_:

Click to download the PDB-style file with coordinates for d6xbta_.
(The format of our PDB-style files is described here.)

Timeline for d6xbta_: