Lineage for d1ec9c2 (1ec9 C:4-137)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554473Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2554490Protein D-glucarate dehydratase [54831] (2 species)
  7. 2554491Species Escherichia coli [TaxId:562] [54833] (7 PDB entries)
  8. 2554508Domain d1ec9c2: 1ec9 C:4-137 [38872]
    Other proteins in same PDB: d1ec9a1, d1ec9b1, d1ec9c1, d1ec9d1
    complexed with ipa, mg, xyh

Details for d1ec9c2

PDB Entry: 1ec9 (more details), 2 Å

PDB Description: e. coli glucarate dehydratase bound to xylarohydroxamate
PDB Compounds: (C:) glucarate dehydratase

SCOPe Domain Sequences for d1ec9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ec9c2 d.54.1.1 (C:4-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
qfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirk
tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl
lgqhlgvnvasllg

SCOPe Domain Coordinates for d1ec9c2:

Click to download the PDB-style file with coordinates for d1ec9c2.
(The format of our PDB-style files is described here.)

Timeline for d1ec9c2: