| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) ![]() |
| Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
| Protein D-glucarate dehydratase [54831] (2 species) |
| Species Escherichia coli [TaxId:562] [54833] (6 PDB entries) |
| Domain d1ec9b2: 1ec9 B:4-137 [38871] Other proteins in same PDB: d1ec9a1, d1ec9b1, d1ec9c1, d1ec9d1 complexed with ipa, mg, xyh |
PDB Entry: 1ec9 (more details), 2 Å
SCOPe Domain Sequences for d1ec9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ec9b2 d.54.1.1 (B:4-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
qfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirk
tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl
lgqhlgvnvasllg
Timeline for d1ec9b2: