Lineage for d1ec8b2 (1ec8 B:5-137)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025940Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1025941Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 1025942Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1025959Protein D-glucarate dehydratase [54831] (2 species)
  7. 1025960Species Escherichia coli [TaxId:562] [54833] (6 PDB entries)
  8. 1025966Domain d1ec8b2: 1ec8 B:5-137 [38867]
    Other proteins in same PDB: d1ec8a1, d1ec8b1, d1ec8c1, d1ec8d1
    complexed with glr, ipa, mg

Details for d1ec8b2

PDB Entry: 1ec8 (more details), 1.9 Å

PDB Description: e. coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate
PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d1ec8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ec8b2 d.54.1.1 (B:5-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
gqhlgvnvasllg

SCOPe Domain Coordinates for d1ec8b2:

Click to download the PDB-style file with coordinates for d1ec8b2.
(The format of our PDB-style files is described here.)

Timeline for d1ec8b2: