Lineage for d1nel_2 (1nel 1-141)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191752Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
  4. 191753Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 191754Family d.54.1.1: Enolase N-terminal domain-like [54827] (8 proteins)
  6. 191797Protein Enolase [54828] (3 species)
  7. 191798Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (12 PDB entries)
  8. 191817Domain d1nel_2: 1nel 1-141 [38858]
    Other proteins in same PDB: d1nel_1

Details for d1nel_2

PDB Entry: 1nel (more details), 2.6 Å

PDB Description: fluoride inhibition of yeast enolase: crystal structure of the enolase-mg2+-f--pi complex at 2.6-angstroms resolution

SCOP Domain Sequences for d1nel_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nel_2 d.54.1.1 (1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvsdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d1nel_2:

Click to download the PDB-style file with coordinates for d1nel_2.
(The format of our PDB-style files is described here.)

Timeline for d1nel_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nel_1