Lineage for d6kd6c_ (6kd6 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394399Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 2394400Protein automated matches [191144] (3 species)
    not a true protein
  7. 2394403Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231239] (5 PDB entries)
  8. 2394406Domain d6kd6c_: 6kd6 C: [388485]
    Other proteins in same PDB: d6kd6b2
    automated match to d2m16a_

Details for d6kd6c_

PDB Entry: 6kd6 (more details), 1.58 Å

PDB Description: shuguo pwwp domain
PDB Compounds: (C:) LD23804p

SCOPe Domain Sequences for d6kd6c_:

Sequence, based on SEQRES records: (download)

>d6kd6c_ b.34.9.0 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
asysigdlvfakvkgyppwpakitksnnnkkynvyfygtgetanikledlfpyasnkerf
atekimkrakfieaidqiesalr

Sequence, based on observed residues (ATOM records): (download)

>d6kd6c_ b.34.9.0 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
asysigdlvfakvkgyppwpakitksnkkynvyfygtgetanikledlfpyasnkerfat
ekimkrakfieaidqiesalr

SCOPe Domain Coordinates for d6kd6c_:

Click to download the PDB-style file with coordinates for d6kd6c_.
(The format of our PDB-style files is described here.)

Timeline for d6kd6c_: