Lineage for d1oneb2 (1one B:1-141)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025940Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1025941Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 1025942Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1025985Protein Enolase [54828] (8 species)
  7. 1025986Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (16 PDB entries)
  8. 1025992Domain d1oneb2: 1one B:1-141 [38845]
    Other proteins in same PDB: d1onea1, d1oneb1
    complexed with mg, pep

Details for d1oneb2

PDB Entry: 1one (more details), 1.8 Å

PDB Description: yeast enolase complexed with an equilibrium mixture of 2'-phosphoglyceate and phosphoenolpyruvate
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d1oneb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oneb2 d.54.1.1 (B:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOPe Domain Coordinates for d1oneb2:

Click to download the PDB-style file with coordinates for d1oneb2.
(The format of our PDB-style files is described here.)

Timeline for d1oneb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oneb1