| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) ![]() |
| Family d.79.4.0: automated matches [227181] (1 protein) not a true family |
| Protein automated matches [226901] (10 species) not a true protein |
| Species Stenotrophomonas maltophilia [TaxId:522373] [388341] (1 PDB entry) |
| Domain d6xepa1: 6xep A:1-138 [388342] Other proteins in same PDB: d6xepa2, d6xepa3 automated match to d5cm7a1 complexed with edo, na |
PDB Entry: 6xep (more details), 1.8 Å
SCOPe Domain Sequences for d6xepa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xepa1 d.79.4.0 (A:1-138) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
mslaefalidrirartlerddillgigddaallqpraneqlvvtadtlnsgvhfpvetra
fdigwktlavnlsdlaamgarpawctlalslpeasedwieafgdgffaladqhdialigg
dttrgplslsvtamgqvg
Timeline for d6xepa1: