Lineage for d6xepa1 (6xep A:1-138)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566869Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2566954Family d.79.4.0: automated matches [227181] (1 protein)
    not a true family
  6. 2566955Protein automated matches [226901] (10 species)
    not a true protein
  7. 2566987Species Stenotrophomonas maltophilia [TaxId:522373] [388341] (1 PDB entry)
  8. 2566988Domain d6xepa1: 6xep A:1-138 [388342]
    Other proteins in same PDB: d6xepa2, d6xepa3
    automated match to d5cm7a1
    complexed with edo, na

Details for d6xepa1

PDB Entry: 6xep (more details), 1.8 Å

PDB Description: crystal structure of thiamine-monophosphate kinase from stenotrophomonas maltophilia k279a
PDB Compounds: (A:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d6xepa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xepa1 d.79.4.0 (A:1-138) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
mslaefalidrirartlerddillgigddaallqpraneqlvvtadtlnsgvhfpvetra
fdigwktlavnlsdlaamgarpawctlalslpeasedwieafgdgffaladqhdialigg
dttrgplslsvtamgqvg

SCOPe Domain Coordinates for d6xepa1:

Click to download the PDB-style file with coordinates for d6xepa1.
(The format of our PDB-style files is described here.)

Timeline for d6xepa1: