Lineage for d1gpmd3 (1gpm D:405-525)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648684Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1648703Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families) (S)
    automatically mapped to Pfam PF00958
  5. 1648704Family d.52.2.1: GMP synthetase C-terminal dimerisation domain [54811] (1 protein)
  6. 1648705Protein GMP synthetase C-terminal dimerisation domain [54812] (2 species)
  7. 1648706Species Escherichia coli [TaxId:562] [54813] (1 PDB entry)
  8. 1648710Domain d1gpmd3: 1gpm D:405-525 [38829]
    Other proteins in same PDB: d1gpma1, d1gpma2, d1gpmb1, d1gpmb2, d1gpmc1, d1gpmc2, d1gpmd1, d1gpmd2
    complexed with amp, cit, mg, po4, pop

Details for d1gpmd3

PDB Entry: 1gpm (more details), 2.2 Å

PDB Description: escherichia coli gmp synthetase complexed with amp and pyrophosphate
PDB Compounds: (D:) gmp synthetase

SCOPe Domain Sequences for d1gpmd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpmd3 d.52.2.1 (D:405-525) GMP synthetase C-terminal dimerisation domain {Escherichia coli [TaxId: 562]}
gpglgvrvlgevkkeycdllrradaifieelrkadlydkvsqaftvflpvrsvgvmgdgr
kydwvvslravetidfmtahwahlpydflgrvsnriinevngisrvvydisgkppatiew
e

SCOPe Domain Coordinates for d1gpmd3:

Click to download the PDB-style file with coordinates for d1gpmd3.
(The format of our PDB-style files is described here.)

Timeline for d1gpmd3: