| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (1 family) ![]() |
| Family d.52.2.1: GMP synthetase C-terminal dimerisation domain [54811] (1 protein) |
| Protein GMP synthetase C-terminal dimerisation domain [54812] (1 species) |
| Species Escherichia coli [TaxId:562] [54813] (1 PDB entry) |
| Domain d1gpmb3: 1gpm B:405-525 [38827] Other proteins in same PDB: d1gpma1, d1gpma2, d1gpmb1, d1gpmb2, d1gpmc1, d1gpmc2, d1gpmd1, d1gpmd2 |
PDB Entry: 1gpm (more details), 2.2 Å
SCOP Domain Sequences for d1gpmb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpmb3 d.52.2.1 (B:405-525) GMP synthetase C-terminal dimerisation domain {Escherichia coli}
gpglgvrvlgevkkeycdllrradaifieelrkadlydkvsqaftvflpvrsvgvmgdgr
kydwvvslravetidfmtahwahlpydflgrvsnriinevngisrvvydisgkppatiew
e
Timeline for d1gpmb3: