![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) ![]() share similar mode of ligand (Adenosine group) binding the first three families are more closely related to each other as the last two families are |
![]() | Family c.26.2.1: N-type ATP pyrophosphatases [52403] (5 proteins) |
![]() | Protein GMP synthetase, central domain [52404] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52405] (1 PDB entry) |
![]() | Domain d1gpma1: 1gpm A:208-404 [31608] Other proteins in same PDB: d1gpma2, d1gpma3, d1gpmb2, d1gpmb3, d1gpmc2, d1gpmc3, d1gpmd2, d1gpmd3 |
PDB Entry: 1gpm (more details), 2.2 Å
SCOP Domain Sequences for d1gpma1:
Sequence, based on SEQRES records: (download)
>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli} wtpakiiddavarireqvgddkvilglsggvdssvtamllhraigknltcvfvdngllrl neaeqvldmfgdhfglnivhvpaedrflsalagendpeakrkiigrvfvevfdeealkle dvkwlaqgtiypdviesaasatgkahvikshhnvgglpkemkmglveplkelfkdevrki glelglpydmlyrhpfp
>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli} wtpakiiddavarireqvgddkvilglsggvdssvtamllhraigknltcvfvdngllrl neaeqvldmfgdhfglnivhvpaedrflsalagendpeakrkiigrvfvevfdeealkle dvkwlaqgtiypdviesaakmglveplkelfkdevrkiglelglpydmlyrhpfp
Timeline for d1gpma1: