Lineage for d1gpma1 (1gpm A:208-404)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312145Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 312411Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    the first three families are more closely related to each other as the last two families are
  5. 312412Family c.26.2.1: N-type ATP pyrophosphatases [52403] (5 proteins)
  6. 312466Protein GMP synthetase, central domain [52404] (1 species)
  7. 312467Species Escherichia coli [TaxId:562] [52405] (1 PDB entry)
  8. 312468Domain d1gpma1: 1gpm A:208-404 [31608]
    Other proteins in same PDB: d1gpma2, d1gpma3, d1gpmb2, d1gpmb3, d1gpmc2, d1gpmc3, d1gpmd2, d1gpmd3

Details for d1gpma1

PDB Entry: 1gpm (more details), 2.2 Å

PDB Description: escherichia coli gmp synthetase complexed with amp and pyrophosphate

SCOP Domain Sequences for d1gpma1:

Sequence, based on SEQRES records: (download)

>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli}
wtpakiiddavarireqvgddkvilglsggvdssvtamllhraigknltcvfvdngllrl
neaeqvldmfgdhfglnivhvpaedrflsalagendpeakrkiigrvfvevfdeealkle
dvkwlaqgtiypdviesaasatgkahvikshhnvgglpkemkmglveplkelfkdevrki
glelglpydmlyrhpfp

Sequence, based on observed residues (ATOM records): (download)

>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli}
wtpakiiddavarireqvgddkvilglsggvdssvtamllhraigknltcvfvdngllrl
neaeqvldmfgdhfglnivhvpaedrflsalagendpeakrkiigrvfvevfdeealkle
dvkwlaqgtiypdviesaakmglveplkelfkdevrkiglelglpydmlyrhpfp

SCOP Domain Coordinates for d1gpma1:

Click to download the PDB-style file with coordinates for d1gpma1.
(The format of our PDB-style files is described here.)

Timeline for d1gpma1: