Lineage for d1dt4a_ (1dt4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947087Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2947121Protein Neuro-oncological ventral antigen 1, nova-1, KH3 [54793] (1 species)
  7. 2947122Species Human (Homo sapiens) [TaxId:9606] [54794] (1 PDB entry)
  8. 2947123Domain d1dt4a_: 1dt4 A: [38799]

Details for d1dt4a_

PDB Entry: 1dt4 (more details), 2.6 Å

PDB Description: crystal structure of nova-1 kh3 k-homology rna-binding domain
PDB Compounds: (A:) neuro-oncological ventral antigen 1

SCOPe Domain Sequences for d1dt4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dt4a_ d.51.1.1 (A:) Neuro-oncological ventral antigen 1, nova-1, KH3 {Human (Homo sapiens) [TaxId: 9606]}
mkdvveiavpenlvgailgkggktlveyqeltgcriqiskkgeflpgtrnrkvtitgtpa
atqaaqylitqri

SCOPe Domain Coordinates for d1dt4a_:

Click to download the PDB-style file with coordinates for d1dt4a_.
(The format of our PDB-style files is described here.)

Timeline for d1dt4a_: