PDB entry 1dt4

View 1dt4 on RCSB PDB site
Description: crystal structure of nova-1 kh3 k-homology RNA-binding domain
Class: immune system
Keywords: kh domain, alpha-beta fold, RNA-binding motif, immune system
Deposited on 2000-01-11, released 2000-02-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neuro-oncological ventral antigen 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51513 (0-72)
    • engineered (33)
    • conflict (44)
    • expression artifact (0)
  Domains in SCOPe 2.08: d1dt4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dt4A (A:)
  mkdvveiavpenlvgailgkggktlveyqeltgcriqiskkgeflpgtrnrkvtitgtpa
  atqaaqylitqri