PDB entry 1dt4

View 1dt4 on RCSB PDB site
Description: crystal structure of nova-1 kh3 k-homology RNA-binding domain
Class: immune system
Keywords: kh domain, alpha-beta fold, RNA-binding motif, immune system
Deposited on 2000-01-11, released 2000-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.222
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuro-oncological ventral antigen 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51513 (0-72)
      • engineered (33)
      • conflict (44)
      • expression artifact (0)
    Domains in SCOPe 2.07: d1dt4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dt4A (A:)
    mkdvveiavpenlvgailgkggktlveyqeltgcriqiskkgeflpgtrnrkvtitgtpa
    atqaaqylitqri