Lineage for d6sw5b1 (6sw5 B:16-116)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583085Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries)
  8. 2583179Domain d6sw5b1: 6sw5 B:16-116 [387859]
    automated match to d2obva1
    complexed with edo, peg

Details for d6sw5b1

PDB Entry: 6sw5 (more details), 2.35 Å

PDB Description: crystal structure of the human s-adenosylmethionine synthetase 1 (ligand-free form)
PDB Compounds: (B:) S-adenosylmethionine synthase isoform type-1

SCOPe Domain Sequences for d6sw5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sw5b1 d.130.1.0 (B:16-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvfmftsesvgeghpdkicdqisdavldahlkqdpnakvacetvcktgmvllcgeitsma
mvdyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspd

SCOPe Domain Coordinates for d6sw5b1:

Click to download the PDB-style file with coordinates for d6sw5b1.
(The format of our PDB-style files is described here.)

Timeline for d6sw5b1: