SCOPe 2.08: Domain d1e8sa_: 1e8s A:

Lineage for d1e8sa_ (1e8s A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
   (beta)-alpha-beta(3)-alpha; 2 layers, alpha/beta

4. Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (2 families)

5. Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (2 proteins)

6. Protein Signal recognition particle 9KDa protein, SRP9 [88845] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88846] (2 PDB entries)

8. Domain d1e8sa_: 1e8s A: [38777]
   Other proteins in same PDB: d1e8sb_
   low resolution structure of potential alu retroposition intermediate
   complexed with eu3

Details for d1e8sa_

PDB Entry: 1e8s, 4 Å

PDB Description: alu domain of the mammalian srp (potential alu retroposition intermediate)

PDB Compounds: (A:) signal recognition particle 9 kda protein

SCOPe Domain Sequences for d1e8sa_:

Sequence; same for both SEQRES and ATOM records:

>d1e8sa_ d.49.1.1 (A:) Signal recognition particle 9KDa protein, SRP9 {Human (Homo sapiens) [TaxId: 9606]}
qtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkkiek
fhsqlmrlmva

Timeline for d1e8sa_:

• d1e8sa_ first appeared (with stable ids) in SCOP 1.55
  
• d1e8sa_ appears in SCOPe 2.07