PDB entry 1e8s

View 1e8s on RCSB PDB site
Description: alu domain of the mammalian srp (potential alu retroposition intermediate)
Class: alu ribonucleoprotein particle
Keywords: alu ribonucleoprotein particle, alu rnp assembly and dimerisation, translational control, alu retroposition
Deposited on 2000-09-29, released 2000-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.388
AEROSPACI score: -0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle 9 kda protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e8sa_
  • Chain 'B':
    Compound: signal recognition particle 14 kda protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e8sb_
  • Chain 'C':
    Compound: 7sl RNA, 88-mer
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: EU3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e8sA (A:)
    pqyqtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkk
    iekfhsqlmrlmvakearnvtmete
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8sA (A:)
    qtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkkiek
    fhsqlmrlmva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e8sB (B:)
    vlleseqflteltrlfqkcrtsgsvyitlkkydgrtkpipkkgtvegfepadnkcllrat
    dgkkkistvvsskevnkfqmaysnllranmdglkkrdkknktkktk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e8sB (B:)
    vlleseqflteltrlfqkcrtsgsvyitlkkydgnkcllratdgkkkistvvsskevnkf
    qmaysnllranmdglk
    

  • Chain 'C':
    No sequence available.