Lineage for d1rea_2 (1rea 269-328)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328282Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 328283Superfamily d.48.1: RecA protein, C-terminal domain [54752] (1 family) (S)
  5. 328284Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 328285Protein RecA protein, C-terminal domain [54754] (3 species)
  7. 328286Species Escherichia coli [TaxId:562] [54755] (3 PDB entries)
  8. 328288Domain d1rea_2: 1rea 269-328 [38768]
    Other proteins in same PDB: d1rea_1
    complexed with adp

Details for d1rea_2

PDB Entry: 1rea (more details), 2.7 Å

PDB Description: structure of the reca protein-adp complex

SCOP Domain Sequences for d1rea_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rea_2 d.48.1.1 (269-328) RecA protein, C-terminal domain {Escherichia coli}
nfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelll

SCOP Domain Coordinates for d1rea_2:

Click to download the PDB-style file with coordinates for d1rea_2.
(The format of our PDB-style files is described here.)

Timeline for d1rea_2:

328288
d1rea_2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1rea_1