Lineage for d1reaa2 (1rea A:269-328)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946749Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 2946750Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) (S)
  5. 2946751Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 2946752Protein RecA protein, C-terminal domain [54754] (5 species)
  7. 2946755Species Escherichia coli [TaxId:562] [54755] (9 PDB entries)
    Uniprot P0A7G6 P03017
  8. 2946761Domain d1reaa2: 1rea A:269-328 [38768]
    Other proteins in same PDB: d1reaa1
    protein/DNA complex; complexed with adp

Details for d1reaa2

PDB Entry: 1rea (more details), 2.7 Å

PDB Description: structure of the reca protein-adp complex
PDB Compounds: (A:) rec a

SCOPe Domain Sequences for d1reaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1reaa2 d.48.1.1 (A:269-328) RecA protein, C-terminal domain {Escherichia coli [TaxId: 562]}
nfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelll

SCOPe Domain Coordinates for d1reaa2:

Click to download the PDB-style file with coordinates for d1reaa2.
(The format of our PDB-style files is described here.)

Timeline for d1reaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1reaa1