| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (19 species) not a true protein |
| Species Ruminococcus gnavus [TaxId:33038] [361247] (8 PDB entries) |
| Domain d6jz2b2: 6jz2 B:186-278 [387281] Other proteins in same PDB: d6jz2a1, d6jz2a3, d6jz2b1, d6jz2b3 automated match to d5c71a2 complexed with mpd, mrd, sj5 |
PDB Entry: 6jz2 (more details), 1.29 Å
SCOPe Domain Sequences for d6jz2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jz2b2 b.1.4.0 (B:186-278) automated matches {Ruminococcus gnavus [TaxId: 33038]}
esvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqvanarl
wevrnaylyqivilitdgngvldeyrekigirt
Timeline for d6jz2b2: