Lineage for d6jz2b2 (6jz2 B:186-278)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763250Species Ruminococcus gnavus [TaxId:33038] [361247] (8 PDB entries)
  8. 2763252Domain d6jz2b2: 6jz2 B:186-278 [387281]
    Other proteins in same PDB: d6jz2a1, d6jz2a3, d6jz2b1, d6jz2b3
    automated match to d5c71a2
    complexed with mpd, mrd, sj5

Details for d6jz2b2

PDB Entry: 6jz2 (more details), 1.29 Å

PDB Description: b-glucuronidase from ruminococcus gnavus in complex with uronic isofagomine at 1.3 angstroms resolution
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d6jz2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jz2b2 b.1.4.0 (B:186-278) automated matches {Ruminococcus gnavus [TaxId: 33038]}
esvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqvanarl
wevrnaylyqivilitdgngvldeyrekigirt

SCOPe Domain Coordinates for d6jz2b2:

Click to download the PDB-style file with coordinates for d6jz2b2.
(The format of our PDB-style files is described here.)

Timeline for d6jz2b2: