| Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) ![]() |
| Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [54721] (6 species) |
| Species Thermus thermophilus [TaxId:274] [54723] (2 PDB entries) |
| Domain d1mngb2: 1mng B:93-203 [38702] Other proteins in same PDB: d1mnga1, d1mngb1 |
PDB Entry: 1mng (more details), 1.8 Å
SCOP Domain Sequences for d1mngb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mngb2 d.44.1.1 (B:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus}
ggakepvgelkkaideqfggfqalkekltqaamgrfgsgwawlvkdpfgklhvlstpnqd
npvmegftpivgidvwehayylkyqnrradylqaiwnvlnwdvaeeffkka
Timeline for d1mngb2: