Lineage for d1mngb2 (1mng B:93-203)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191397Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 191398Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 191399Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 191475Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)
  7. 191538Species Thermus thermophilus [TaxId:274] [54723] (2 PDB entries)
  8. 191540Domain d1mngb2: 1mng B:93-203 [38702]
    Other proteins in same PDB: d1mnga1, d1mngb1

Details for d1mngb2

PDB Entry: 1mng (more details), 1.8 Å

PDB Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus

SCOP Domain Sequences for d1mngb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mngb2 d.44.1.1 (B:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus}
ggakepvgelkkaideqfggfqalkekltqaamgrfgsgwawlvkdpfgklhvlstpnqd
npvmegftpivgidvwehayylkyqnrradylqaiwnvlnwdvaeeffkka

SCOP Domain Coordinates for d1mngb2:

Click to download the PDB-style file with coordinates for d1mngb2.
(The format of our PDB-style files is described here.)

Timeline for d1mngb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mngb1