Lineage for d1mmma2 (1mmm A:91-205)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189807Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2189808Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2189809Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2189935Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2189960Species Escherichia coli [TaxId:562] [54722] (12 PDB entries)
  8. 2189997Domain d1mmma2: 1mmm A:91-205 [38699]
    Other proteins in same PDB: d1mmma1, d1mmmb1
    iron-substituted
    complexed with fe, oh

Details for d1mmma2

PDB Entry: 1mmm (more details), 2.2 Å

PDB Description: distinct metal environment in iron-substituted manganese superoxide dismutase provides a structural basis of metal specificity
PDB Compounds: (A:) protein (iron-substituted manganese superoxide dismutase)

SCOPe Domain Sequences for d1mmma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmma2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOPe Domain Coordinates for d1mmma2:

Click to download the PDB-style file with coordinates for d1mmma2.
(The format of our PDB-style files is described here.)

Timeline for d1mmma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mmma1