Lineage for d1vewd2 (1vew D:91-205)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602270Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 602271Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 602272Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 602388Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)
  7. 602404Species Escherichia coli [TaxId:562] [54722] (10 PDB entries)
  8. 602426Domain d1vewd2: 1vew D:91-205 [38694]
    Other proteins in same PDB: d1vewa1, d1vewb1, d1vewc1, d1vewd1
    complexed with mn, oh; mutant

Details for d1vewd2

PDB Entry: 1vew (more details), 2.1 Å

PDB Description: manganese superoxide dismutase from escherichia coli

SCOP Domain Sequences for d1vewd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vewd2 d.44.1.1 (D:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOP Domain Coordinates for d1vewd2:

Click to download the PDB-style file with coordinates for d1vewd2.
(The format of our PDB-style files is described here.)

Timeline for d1vewd2: