Lineage for d1d5nc2 (1d5n C:91-205)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1202223Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1202224Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 1202225Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 1202351Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)
  7. 1202369Species Escherichia coli [TaxId:562] [54722] (11 PDB entries)
  8. 1202380Domain d1d5nc2: 1d5n C:91-205 [38689]
    Other proteins in same PDB: d1d5na1, d1d5nb1, d1d5nc1, d1d5nd1
    complexed with mn

Details for d1d5nc2

PDB Entry: 1d5n (more details), 1.55 Å

PDB Description: crystal structure of e. coli mnsod at 100k
PDB Compounds: (C:) protein (manganese superoxide dismutase)

SCOPe Domain Sequences for d1d5nc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5nc2 d.44.1.1 (C:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOPe Domain Coordinates for d1d5nc2:

Click to download the PDB-style file with coordinates for d1d5nc2.
(The format of our PDB-style files is described here.)

Timeline for d1d5nc2: