| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.43: EF-Ts domain-like [54712] (2 superfamilies) beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123 |
Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) ![]() comprises two structural repeats of this fold |
| Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein) |
| Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species) |
| Species Thermus thermophilus [TaxId:274] [54717] (2 PDB entries) |
| Domain d1tfea_: 1tfe A: [38680] dimer of a one subdomain fragment |
PDB Entry: 1tfe (more details), 1.7 Å
SCOPe Domain Sequences for d1tfea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfea_ d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus [TaxId: 274]}
aregiighyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeeip
aeelekerqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeliq
qaiakigenivvrrfcrfelga
Timeline for d1tfea_: