Lineage for d1efub2 (1efu B:140-282)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411430Fold d.43: EF-Ts domain-like [54712] (2 superfamilies)
    beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123
  4. 1411431Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) (S)
    comprises two structural repeats of this fold
  5. 1411432Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)
  6. 1411433Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species)
  7. 1411437Species Escherichia coli [TaxId:562] [54716] (1 PDB entry)
    duplication: consists of two subdomains of this fold
  8. 1411438Domain d1efub2: 1efu B:140-282 [38677]
    Other proteins in same PDB: d1efua1, d1efua2, d1efua3, d1efub3, d1efuc1, d1efuc2, d1efuc3, d1efud3

Details for d1efub2

PDB Entry: 1efu (more details), 2.5 Å

PDB Description: elongation factor complex ef-tu/ef-ts from escherichia coli
PDB Compounds: (B:) elongation factor ts

SCOPe Domain Sequences for d1efub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efub2 d.43.1.1 (B:140-282) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]}
dvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikpedvsaevvekeyqvqld
iamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvgqllkehnaevtgfirfe
vgegiekvetdfaaevaamskqs

SCOPe Domain Coordinates for d1efub2:

Click to download the PDB-style file with coordinates for d1efub2.
(The format of our PDB-style files is described here.)

Timeline for d1efub2: