![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.43: EF-Ts domain-like [54712] (2 superfamilies) beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123 |
![]() | Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) ![]() comprises two structural repeats of this fold |
![]() | Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (2 proteins) |
![]() | Protein Elongation factor Ts (EF-Ts), dimerisation domain, C-terminal domain [419041] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [419525] (6 PDB entries) species duplication: consists of two subdomains of this fold |
![]() | Domain d1efub2: 1efu B:140-282 [38677] Other proteins in same PDB: d1efua1, d1efua2, d1efua3, d1efub3, d1efub4, d1efuc1, d1efuc2, d1efuc3, d1efud3, d1efud4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1efu (more details), 2.5 Å
SCOPe Domain Sequences for d1efub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efub2 d.43.1.1 (B:140-282) Elongation factor Ts (EF-Ts), dimerisation domain, C-terminal domain {Escherichia coli [TaxId: 562]} dvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikpedvsaevvekeyqvqld iamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvgqllkehnaevtgfirfe vgegiekvetdfaaevaamskqs
Timeline for d1efub2: