Lineage for d1fqvh2 (1fqv H:2-68)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1024736Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1024737Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1024738Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 1024766Protein Cyclin A/CDK2-associated p45, Skp1 [54710] (1 species)
  7. 1024767Species Human (Homo sapiens) [TaxId:9606] [54711] (8 PDB entries)
  8. 1024775Domain d1fqvh2: 1fqv H:2-68 [38669]
    Other proteins in same PDB: d1fqva1, d1fqva2, d1fqvb1, d1fqvc1, d1fqvc2, d1fqvd1, d1fqve1, d1fqve2, d1fqvf1, d1fqvg1, d1fqvg2, d1fqvh1, d1fqvi1, d1fqvi2, d1fqvj1, d1fqvk1, d1fqvk2, d1fqvl1, d1fqvm1, d1fqvm2, d1fqvn1, d1fqvo1, d1fqvo2, d1fqvp1

Details for d1fqvh2

PDB Entry: 1fqv (more details), 2.8 Å

PDB Description: Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
PDB Compounds: (H:) skp1

SCOPe Domain Sequences for d1fqvh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqvh2 d.42.1.1 (H:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
d

SCOPe Domain Coordinates for d1fqvh2:

Click to download the PDB-style file with coordinates for d1fqvh2.
(The format of our PDB-style files is described here.)

Timeline for d1fqvh2: