Lineage for d1a68a_ (1a68 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189359Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2189360Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2189595Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 proteins)
  6. 2189631Protein Shaker potassium channel [54702] (1 species)
  7. 2189632Species California sea hare (Aplysia californica) [TaxId:6500] [54703] (5 PDB entries)
  8. 2189635Domain d1a68a_: 1a68 A: [38639]

Details for d1a68a_

PDB Entry: 1a68 (more details), 1.8 Å

PDB Description: crystal structure of the tetramerization domain of the shaker potassium channel
PDB Compounds: (A:) potassium channel kv1.1

SCOPe Domain Sequences for d1a68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a68a_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]}
ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
qsggrlrrpvnvpldvfseeikfyelg

SCOPe Domain Coordinates for d1a68a_:

Click to download the PDB-style file with coordinates for d1a68a_.
(The format of our PDB-style files is described here.)

Timeline for d1a68a_: