Lineage for d1fmae_ (1fma E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647036Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1647389Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) (S)
  5. 1647390Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein)
    automatically mapped to Pfam PF02391
  6. 1647391Protein Molybdopterin synthase subunit MoaE [54692] (1 species)
  7. 1647392Species Escherichia coli [TaxId:562] [54693] (5 PDB entries)
  8. 1647394Domain d1fmae_: 1fma E: [38630]
    Other proteins in same PDB: d1fmad_
    complexed with MoaD
    complexed with cl

Details for d1fmae_

PDB Entry: 1fma (more details), 1.58 Å

PDB Description: molybdopterin synthase (moad/moae)
PDB Compounds: (E:) molybdopterin converting factor, subunit 2

SCOPe Domain Sequences for d1fmae_:

Sequence, based on SEQRES records: (download)

>d1fmae_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek
alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr
apfwkreatpegdrwvearesdqqaakrw

Sequence, based on observed residues (ATOM records): (download)

>d1fmae_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrvnaltlehypgmtekalaeivd
earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkre
atpegdrwvearesdqqaakrw

SCOPe Domain Coordinates for d1fmae_:

Click to download the PDB-style file with coordinates for d1fmae_.
(The format of our PDB-style files is described here.)

Timeline for d1fmae_: