Lineage for d6kihl_ (6kih L:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2911058Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2911059Protein automated matches [190965] (40 species)
    not a true protein
  7. 2911302Species Thermosynechococcus elongatus [TaxId:146786] [386105] (1 PDB entry)
  8. 2911314Domain d6kihl_: 6kih L: [386134]
    automated match to d3c4va_
    complexed with f6p, glc, udp

Details for d6kihl_

PDB Entry: 6kih (more details), 3 Å

PDB Description: sucrose-phosphate synthase (tll1590) from thermosynechococcus elongatus
PDB Compounds: (L:) Tll1590 protein

SCOPe Domain Sequences for d6kihl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kihl_ c.87.1.0 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 146786]}
rqpialisvhgdpaadvghesaggqniyvrqlgealaaagwhvdmftrktdpndpdvieh
sphcrtirlqagpltyipreklfetlpkfveafkayhakygyplihtnywlsgwvgwqlr
qqfnfqwlhtyhslgvvkyqvaseqaqrdetrlmvekailenadcvivtspqeeaylrrw
vskagqtrlipcgtnlklfypvadaraqlnlpadepivlyvgrfdrrkgietlvaamaqi
pqgqlllvggsdpqrsdgaerrrieglvqeynlgdrvtfvgqidheylavyysaanvcvv
psyyepfglvaieamacgtpviasavgglqftvipeetgllvppqdanalanaiqrilad
pawartlgkngrervqalfnweaialqmgqlyrqlfaasl

SCOPe Domain Coordinates for d6kihl_:

Click to download the PDB-style file with coordinates for d6kihl_.
(The format of our PDB-style files is described here.)

Timeline for d6kihl_: