SCOPe 2.08: Domain d6wvra2: 6wvr A:246-437

Lineage for d6wvra2 (6wvr A:246-437)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)
Domain d6wvra2: 6wvr A:246-437 [385972]
Other proteins in same PDB: d6wvra1, d6wvrb1, d6wvrc1, d6wvrd1
automated match to d4i50a2
complexed with gdp, gtp, mg, ta1

Details for d6wvra2

PDB Entry: 6wvr (more details), 2.9 Å

PDB Description: tubulin dimers from a 13-protofilament, taxol stabilized microtubule

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6wvra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wvra2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d6wvra2:

Click to download the PDB-style file with coordinates for d6wvra2.
(The format of our PDB-style files is described here.)

Timeline for d6wvra2: