Lineage for d1fo4b3 (1fo4 B:537-694)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647036Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1647037Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 1647038Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 1647099Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)
  7. 1647100Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries)
    Uniprot P80457
  8. 1647110Domain d1fo4b3: 1fo4 B:537-694 [38587]
    Other proteins in same PDB: d1fo4a1, d1fo4a2, d1fo4a4, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b2, d1fo4b4, d1fo4b5, d1fo4b6
    complexed with ca, fad, fes, gol, mos, mte, sal

Details for d1fo4b3

PDB Entry: 1fo4 (more details), 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk
PDB Compounds: (B:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1fo4b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo4b3 d.41.1.1 (B:537-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]}
kldptytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddi
pryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfa
kdtvtcvghiigavvadtpehaeraahvvkvtyedlpa

SCOPe Domain Coordinates for d1fo4b3:

Click to download the PDB-style file with coordinates for d1fo4b3.
(The format of our PDB-style files is described here.)

Timeline for d1fo4b3: