SCOPe 2.02: Domain d1sbni_: 1sbn I:

Lineage for d1sbni_ (1sbn I:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)

6. Protein Eglin C [54656] (1 species)

7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)

8. Domain d1sbni_: 1sbn I: [38567]
   Other proteins in same PDB: d1sbne_
   complexed with ca; mutant

Details for d1sbni_

PDB Entry: 1sbn, 2.1 Å

PDB Description: refined crystal structures of subtilisin novo in complex with wild- type and two mutant eglins. comparison with other serine proteinase inhibitor complexes

PDB Compounds: (I:) eglin c

SCOPe Domain Sequences for d1sbni_:

Sequence; same for both SEQRES and ATOM records:

>d1sbni_ d.40.1.1 (I:) Eglin C {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
ksfpevvgktvdqareyftlhypqynvyflpegspvtrdlrynrvrvfynpgtnvvnhvp
hvg

Timeline for d1sbni_:

• d1sbni_ first appeared (with stable ids) in SCOP 1.55
  
• d1sbni_ appears in SCOPe 2.01
  
• d1sbni_ appears in SCOPe 2.03
  
• d1sbni_ appears in the current release, SCOPe 2.08