Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.39: DLC [54647] (1 superfamily) core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342 |
Superfamily d.39.1: DLC [54648] (1 family) automatically mapped to Pfam PF01221 |
Family d.39.1.1: DLC [54649] (3 proteins) 8 kDa dynein light chain, DLC8 |
Protein Dynein light chain 1 (DLC1) [54650] (3 species) synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [54652] (5 PDB entries) |
Domain d1f95a_: 1f95 A: [38555] complex with a BIM peptide |
PDB Entry: 1f95 (more details)
SCOPe Domain Sequences for d1f95a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f95a_ d.39.1.1 (A:) Dynein light chain 1 (DLC1) {Norway rat (Rattus norvegicus) [TaxId: 10116]} mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr nfgsyvthetkhfiyfylgqvaillfksg
Timeline for d1f95a_: