Lineage for d6rc7a_ (6rc7 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032326Protein automated matches [190676] (9 species)
    not a true protein
  7. 3032347Species Monocled cobra (Naja kaouthia) [TaxId:8649] [385539] (2 PDB entries)
  8. 3032349Domain d6rc7a_: 6rc7 A: [385540]
    automated match to d1chvs_

Details for d6rc7a_

PDB Entry: 6rc7 (more details)

PDB Description: nmr structure of cytotoxin 3 from naja kaouthia in solution, major form
PDB Compounds: (A:) cytotoxin 3

SCOPe Domain Sequences for d6rc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rc7a_ g.7.1.1 (A:) automated matches {Monocled cobra (Naja kaouthia) [TaxId: 8649]}
lkcnkliplayktcpagknlcykmfmvsnktvpvkrgcidacpknsllvkyvccntdrcn

SCOPe Domain Coordinates for d6rc7a_:

Click to download the PDB-style file with coordinates for d6rc7a_.
(The format of our PDB-style files is described here.)

Timeline for d6rc7a_: