![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
![]() | Protein automated matches [190676] (9 species) not a true protein |
![]() | Species Monocled cobra (Naja kaouthia) [TaxId:8649] [385539] (2 PDB entries) |
![]() | Domain d6rc7a_: 6rc7 A: [385540] automated match to d1chvs_ |
PDB Entry: 6rc7 (more details)
SCOPe Domain Sequences for d6rc7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rc7a_ g.7.1.1 (A:) automated matches {Monocled cobra (Naja kaouthia) [TaxId: 8649]} lkcnkliplayktcpagknlcykmfmvsnktvpvkrgcidacpknsllvkyvccntdrcn
Timeline for d6rc7a_: