Lineage for d6rcfa_ (6rcf A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412995Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. 2413033Protein automated matches [226957] (2 species)
    not a true protein
  7. 2413034Species Human (Homo sapiens) [TaxId:9606] [225382] (12 PDB entries)
  8. 2413037Domain d6rcfa_: 6rcf A: [385524]
    automated match to d2iyba_
    complexed with k0k, no3

Details for d6rcfa_

PDB Entry: 6rcf (more details), 1.1 Å

PDB Description: enah evh1 in complex with ac-[2-cl-f]-[prom-2]-[prom-15]-oh
PDB Compounds: (A:) Protein enabled homolog

SCOPe Domain Sequences for d6rcfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rcfa_ b.55.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvi
ncaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl

SCOPe Domain Coordinates for d6rcfa_:

Click to download the PDB-style file with coordinates for d6rcfa_.
(The format of our PDB-style files is described here.)

Timeline for d6rcfa_: