SCOPe 2.02: Domain d1cmib_: 1cmi B:

Lineage for d1cmib_ (1cmi B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.39: DLC [54647] (1 superfamily)
   core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342

4. Superfamily d.39.1: DLC [54648] (1 family)

5. Family d.39.1.1: DLC [54649] (3 proteins)
   8 kDa dynein light chain, DLC8

6. Protein Dynein light chain 1 (DLC1) [54650] (3 species)
   synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase

7. Species Human (Homo sapiens) [TaxId:9606] [54651] (1 PDB entry)

8. Domain d1cmib_: 1cmi B: [38552]
   complex with a NOS peptide (residue 230-242)

Details for d1cmib_

PDB Entry: 1cmi, 2.5 Å

PDB Description: structure of the human pin/lc8 dimer with a bound peptide

PDB Compounds: (B:) protein inhibitor of neuronal nitric oxide synthase

SCOPe Domain Sequences for d1cmib_:

Sequence; same for both SEQRES and ATOM records:

>d1cmib_ d.39.1.1 (B:) Dynein light chain 1 (DLC1) {Human (Homo sapiens) [TaxId: 9606]}
kaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgrnfgs
yvthetkhfiyfylgqvaillfksg

Timeline for d1cmib_:

• d1cmib_ first appeared (with stable ids) in SCOP 1.55
  
• d1cmib_ appears in SCOPe 2.01
  
• d1cmib_ appears in SCOPe 2.03
  
• d1cmib_ appears in the current release, SCOPe 2.08