Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.39: DLC [54647] (1 superfamily) core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342 |
Superfamily d.39.1: DLC [54648] (1 family) |
Family d.39.1.1: DLC [54649] (3 proteins) 8 kDa dynein light chain, DLC8 |
Protein Dynein light chain 1 (DLC1) [54650] (3 species) synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase |
Species Human (Homo sapiens) [TaxId:9606] [54651] (1 PDB entry) |
Domain d1cmib_: 1cmi B: [38552] complex with a NOS peptide (residue 230-242) |
PDB Entry: 1cmi (more details), 2.5 Å
SCOPe Domain Sequences for d1cmib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmib_ d.39.1.1 (B:) Dynein light chain 1 (DLC1) {Human (Homo sapiens) [TaxId: 9606]} kaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgrnfgs yvthetkhfiyfylgqvaillfksg
Timeline for d1cmib_: