Lineage for d1c8ua1 (1c8u A:2-115)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2187933Family d.38.1.3: Acyl-CoA thioesterase [54644] (2 proteins)
    duplication: consists of two domains of this fold
  6. 2187940Protein Thioesterase II (TesB) [54645] (1 species)
  7. 2187941Species Escherichia coli [TaxId:562] [54646] (1 PDB entry)
  8. 2187942Domain d1c8ua1: 1c8u A:2-115 [38547]
    complexed with lda

Details for d1c8ua1

PDB Entry: 1c8u (more details), 1.9 Å

PDB Description: crystal structure of the e.coli thioesterase ii, a homologue of the human nef-binding enzyme
PDB Compounds: (A:) acyl-coa thioesterase II

SCOPe Domain Sequences for d1c8ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8ua1 d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]}
sqalknlltllnlekieeglfrgqsedlglrqvfggqvvgqalyaaketvpeerlvhsfh
syflrpgdskkpiiydvetlrdgnsfsarrvaaiqngkpifymtasfqapeagf

SCOPe Domain Coordinates for d1c8ua1:

Click to download the PDB-style file with coordinates for d1c8ua1.
(The format of our PDB-style files is described here.)

Timeline for d1c8ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c8ua2