Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.3: Acyl-CoA thioesterase [54644] (2 proteins) duplication: consists of two domains of this fold |
Protein Thioesterase II (TesB) [54645] (1 species) |
Species Escherichia coli [TaxId:562] [54646] (1 PDB entry) |
Domain d1c8ua1: 1c8u A:2-115 [38547] complexed with lda |
PDB Entry: 1c8u (more details), 1.9 Å
SCOPe Domain Sequences for d1c8ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8ua1 d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} sqalknlltllnlekieeglfrgqsedlglrqvfggqvvgqalyaaketvpeerlvhsfh syflrpgdskkpiiydvetlrdgnsfsarrvaaiqngkpifymtasfqapeagf
Timeline for d1c8ua1: