Lineage for d1eypb_ (1eyp B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167377Fold d.36: Chalcone isomerase [54625] (1 superfamily)
    beta(3)-alpha(2)-beta-alpha(2)-beta3; 2 layers alpha/beta; antiparallel sheet: order 1234567
  4. 2167378Superfamily d.36.1: Chalcone isomerase [54626] (2 families) (S)
    automatically mapped to Pfam PF02431
  5. 2167379Family d.36.1.1: Chalcone isomerase [54627] (1 protein)
  6. 2167380Protein Chalcone isomerase [54628] (1 species)
  7. 2167381Species Alfalfa (Medicago sativa) [TaxId:3879] [54629] (7 PDB entries)
  8. 2167397Domain d1eypb_: 1eyp B: [38537]

Details for d1eypb_

PDB Entry: 1eyp (more details), 2.5 Å

PDB Description: chalcone isomerase
PDB Compounds: (B:) chalcone-flavonone isomerase 1

SCOPe Domain Sequences for d1eypb_:

Sequence, based on SEQRES records: (download)

>d1eypb_ d.36.1.1 (B:) Chalcone isomerase {Alfalfa (Medicago sativa) [TaxId: 3879]}
asitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvylediavasl
aakwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvg
tygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienka
vssavletmigehavspdlkrclaarlpallne

Sequence, based on observed residues (ATOM records): (download)

>d1eypb_ d.36.1.1 (B:) Chalcone isomerase {Alfalfa (Medicago sativa) [TaxId: 3879]}
asitaitvenleypavvtspvtgksyflggagerglikftaigvylediavaslaakwkg
ksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgtygdae
aeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkavssavl
etmigehavspdlkrclaarlpallne

SCOPe Domain Coordinates for d1eypb_:

Click to download the PDB-style file with coordinates for d1eypb_.
(The format of our PDB-style files is described here.)

Timeline for d1eypb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1eypa_