PDB entry 1eyp

View 1eyp on RCSB PDB site
Description: chalcone isomerase
Class: isomerase
Keywords: chalcone isomerase
Deposited on 2000-05-08, released 2000-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.249
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chalcone-flavonone isomerase 1
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1eypa_
  • Chain 'B':
    Compound: chalcone-flavonone isomerase 1
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1eypb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eypA (A:)
    maasitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvylediava
    slaakwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlks
    vgtygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalien
    kavssavletmigehavspdlkrclaarlpallnegafkign
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eypA (A:)
    sitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvylediavasla
    akwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgt
    ygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkav
    ssavletmigehavspdlkrclaarlpallne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eypB (B:)
    maasitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvylediava
    slaakwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlks
    vgtygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalien
    kavssavletmigehavspdlkrclaarlpallnegafkign
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eypB (B:)
    asitaitvenleypavvtspvtgksyflggagerglikftaigvylediavaslaakwkg
    ksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgtygdae
    aeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkavssavl
    etmigehavspdlkrclaarlpallne