SCOPe 2.08: Domain d6yhwa_: 6yhw A:

Lineage for d6yhwa_ (6yhw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein automated matches [190569] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188033] (6 PDB entries)

8. Domain d6yhwa_: 6yhw A: [385245]
   automated match to d3zl2a_
   complexed with glc, hp6, man, ta5

Details for d6yhwa_

PDB Entry: 6yhw, 1.96 Å

PDB Description: co-crystals in the p212121 space group, of a beta-cyclodextrin spacered by triazole heptyl from alpha-d-mannose, with fimh lectin at 2.00 a resolution.

PDB Compounds: (A:) FimH

SCOPe Domain Sequences for d6yhwa_:

Sequence; same for both SEQRES and ATOM records:

>d6yhwa_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvptg

Timeline for d6yhwa_:

• d6yhwa_ first appeared in SCOPe 2.07