Class a: All alpha proteins [46456] (290 folds) |
Fold a.65: Annexin [47873] (1 superfamily) 5 helices; folded leaf, closed |
Superfamily a.65.1: Annexin [47874] (2 families) duplication: consists of four domains of the same fold |
Family a.65.1.0: automated matches [191494] (1 protein) not a true family |
Protein automated matches [190800] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [385068] (1 PDB entry) |
Domain d6tu2a_: 6tu2 A: [385129] automated match to d1w7ba_ complexed with ca |
PDB Entry: 6tu2 (more details), 2.3 Å
SCOPe Domain Sequences for d6tu2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tu2a_ a.65.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rgtitdasgfdplrdaevlrkamkgfgtdeqaiidclgsrsnkqrqqillsfktaygkdl ikdlkselsgnfektilalmktpvlfdvyeikeaikgagtdeaclieilasrsnehirel nrayktefkktleeairsdtsghfqrllislsqgnrdestnvdmslvqrdvqelyaagen rlgtdeskfnailcsrsrahlvavfneyqrmtgrdieksicremsgdleqgmlavvkclk ntpaffaerlnkamrgagtkdrtlirimvsrseldlldiraeykrmygkslyhditgdts gdyrkillkicggn
Timeline for d6tu2a_: