Lineage for d6tu2a_ (6tu2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717205Family a.65.1.0: automated matches [191494] (1 protein)
    not a true family
  6. 2717206Protein automated matches [190800] (2 species)
    not a true protein
  7. 2717218Species Norway rat (Rattus norvegicus) [TaxId:10116] [385068] (1 PDB entry)
  8. 2717219Domain d6tu2a_: 6tu2 A: [385129]
    automated match to d1w7ba_
    complexed with ca

Details for d6tu2a_

PDB Entry: 6tu2 (more details), 2.3 Å

PDB Description: crystal structure of rat annexin a11
PDB Compounds: (A:) Annexin

SCOPe Domain Sequences for d6tu2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tu2a_ a.65.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rgtitdasgfdplrdaevlrkamkgfgtdeqaiidclgsrsnkqrqqillsfktaygkdl
ikdlkselsgnfektilalmktpvlfdvyeikeaikgagtdeaclieilasrsnehirel
nrayktefkktleeairsdtsghfqrllislsqgnrdestnvdmslvqrdvqelyaagen
rlgtdeskfnailcsrsrahlvavfneyqrmtgrdieksicremsgdleqgmlavvkclk
ntpaffaerlnkamrgagtkdrtlirimvsrseldlldiraeykrmygkslyhditgdts
gdyrkillkicggn

SCOPe Domain Coordinates for d6tu2a_:

Click to download the PDB-style file with coordinates for d6tu2a_.
(The format of our PDB-style files is described here.)

Timeline for d6tu2a_: