Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins) |
Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species) |
Species Pseudomonas sp. [TaxId:306] [54604] (6 PDB entries) |
Domain d1eira2: 1eir A:133-289 [38501] |
PDB Entry: 1eir (more details), 2 Å
SCOP Domain Sequences for d1eira2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eira2 d.32.1.3 (A:133-289) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp.} vsgfvtgdqgighfvrcvpdtakamafytevlgfvlsdiidiqmgpetsvpahflhcngr hhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrhtndqtlsfyadt pspmievefgwgprtvdsswtvarhsrtamwghksvr
Timeline for d1eira2: