Lineage for d1fa6b_ (1fa6 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900809Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1900810Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1900811Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
    duplication: consists of two clear structural repeats each having this fold
  6. 1900812Protein Glyoxalase I (lactoylglutathione lyase) [54595] (3 species)
  7. 1900813Species Escherichia coli [TaxId:562] [54597] (5 PDB entries)
  8. 1900819Domain d1fa6b_: 1fa6 B: [38491]
    complexed with co

Details for d1fa6b_

PDB Entry: 1fa6 (more details), 1.9 Å

PDB Description: crystal structure of the co(ii)-bound glyoxalase i of escherichia coli
PDB Compounds: (B:) Glyoxalase I

SCOPe Domain Sequences for d1fa6b_:

Sequence, based on SEQRES records: (download)

>d1fa6b_ d.32.1.1 (B:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]}
mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn
wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk
ielieekdagrglgn

Sequence, based on observed residues (ATOM records): (download)

>d1fa6b_ d.32.1.1 (B:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]}
mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn
wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk
ielieegn

SCOPe Domain Coordinates for d1fa6b_:

Click to download the PDB-style file with coordinates for d1fa6b_.
(The format of our PDB-style files is described here.)

Timeline for d1fa6b_: