Lineage for d1fa6b_ (1fa6 B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31626Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 31627Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (3 families) (S)
  5. 31628Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (1 protein)
  6. 31629Protein Glyoxalase I (lactoylglutathione lyase) [54595] (2 species)
  7. 31630Species Escherichia coli [TaxId:562] [54597] (5 PDB entries)
  8. 31638Domain d1fa6b_: 1fa6 B: [38491]

Details for d1fa6b_

PDB Entry: 1fa6 (more details), 1.9 Å

PDB Description: crystal structure of the co(ii)-bound glyoxalase i of escherichia coli

SCOP Domain Sequences for d1fa6b_:

Sequence, based on SEQRES records: (download)

>d1fa6b_ d.32.1.1 (B:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli}
mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn
wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk
ielieekdagrglgn

Sequence, based on observed residues (ATOM records): (download)

>d1fa6b_ d.32.1.1 (B:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli}
mrllhtmlrvgdlqrsidfytkvlgmkllrtsenpeykyslafvgygpeteeavieltyn
wgvdkyelgtayghialsvdnaaeacekirqnggnvtreagpvkggttviafvedpdgyk
ielieegn

SCOP Domain Coordinates for d1fa6b_:

Click to download the PDB-style file with coordinates for d1fa6b_.
(The format of our PDB-style files is described here.)

Timeline for d1fa6b_: