Lineage for d6pncb_ (6pnc B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2609056Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2609057Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2609058Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2610000Protein automated matches [190421] (6 species)
    not a true protein
  7. 2610172Species Human (Homo sapiens) [TaxId:9606] [187302] (87 PDB entries)
  8. 2610310Domain d6pncb_: 6pnc B: [384740]
    automated match to d4ucha_
    complexed with h4b, hem, oug, zn; mutant

Details for d6pncb_

PDB Entry: 6pnc (more details), 2.15 Å

PDB Description: structure of human neuronal nitric oxide synthase r354a/g357d mutant heme domain in complex with 7-(3-(2-aminoethyl)phenyl)-4- methylquinolin-2-amine
PDB Compounds: (B:) Nitric oxide synthase, brain

SCOPe Domain Sequences for d6pncb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pncb_ d.174.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfpl
akefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvg
riqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwns
qliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqip
pelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrd
ycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsates
fikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

SCOPe Domain Coordinates for d6pncb_:

Click to download the PDB-style file with coordinates for d6pncb_.
(The format of our PDB-style files is described here.)

Timeline for d6pncb_: