Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) automatically mapped to Pfam PF02898 |
Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins) |
Protein automated matches [190421] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187302] (87 PDB entries) |
Domain d6pncb_: 6pnc B: [384740] automated match to d4ucha_ complexed with h4b, hem, oug, zn; mutant |
PDB Entry: 6pnc (more details), 2.15 Å
SCOPe Domain Sequences for d6pncb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pncb_ d.174.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} prflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfpl akefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvg riqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwns qliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqip pelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrd ycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsates fikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
Timeline for d6pncb_: